Skip to content
HelixEVOLabs home
Sign in
HelixEVO LabsSemaglutide6 mgLOT ________For research use only. Not for human or veterinary use.STORE 2–8 °CHelixEVO LabsSemaglutide6 mgLOT ________For research use only.Not for human or veterinary use.STORE 2–8 °C
Research peptide

Semaglutide

Semaglutide

Specification
Total quantity
6 mg
Pack
Sealed glass vial(s); vial count confirmed before release
Form
Lyophilised powder
Stated purity
Reported per lot on the certificate of analysis
Appearance
Lyophilised white to almost white hygroscopic powder in a sealed glass vial.
Storage
2–8 °C, sealed, protected from light
Shipping
Dispatched from the United Kingdom under cold chain, Monday to Wednesday only, so that no consignment is held in transit over a weekend. Insulated packaging with gel coolant, on a tracked service.
SKU
HX-SEMA-06
AvailabilityOut of stock

Pricing releasing soon. Leave an email to be told once, or request a wholesale quote now.

Request a wholesale quote
For laboratory research use only. Not for human or veterinary consumption.

Analytical data

Latest released lotNo released lot yet

Analytical data appear here as soon as the first lot is released. Every released lot carries a certificate with HPLC purity and MS identity per compound.

Method

Purity by reversed-phase HPLC with UV detection; identity by electrospray mass spectrometry against the calculated monoisotopic or average mass. Endotoxin where stated. The certificate names the laboratory and the method for every result.

How to read a certificate →

Identity

Identity · Semaglutideverified 2026-09-21
In this product
6 mg
Synonyms
NN9535, NN-9535, NNC 0113-0217, NNC-0113-0217, Ozempic, Rybelsus, Wegovy, Wegovy HD, Wegovy FlexTouch, semaglutidum, semaglutida, A10BJ06 (ATC code), CHEMBL2108724, DB13928
CAS
910463-68-2· National Center for Biotechnology Information, NIH NCATS / FDA Global Substance Registration System
UNII
53AXN4NNHX· NIH NCATS / FDA Global Substance Registration System, National Center for Biotechnology Information
PubChem CID
56843331
Formula
C187H291N45O59· National Center for Biotechnology Information, DailyMed, US National Library of Medicine (labeller Novo Nordisk), NIH NCATS / FDA Global Substance Registration System
Mol. weight
4113.58 g/mol· DailyMed, US National Library of Medicine (labeller Novo Nordisk), European Medicines Agency, National Center for Biotechnology Information, NIH NCATS / FDA Global Substance Registration System
Class
Acylated glucagon-like peptide-1 (GLP-1) analogue; GLP-1 receptor agonist; ATC A10BJ06
Targets
GLP-1 receptor (agonist)
Modifications
Aib (2-aminoisobutyric acid) in place of Ala at GLP-1 position 8 (position 2 of the 31-residue chain); stated purpose on the US label: stabilisation against DPP-4 degradation; Arg in place of Lys at GLP-1 position 34 (position 28 of the chain); stated purpose on the US label: to ensure attachment of only one fatty di-acid; Lys at GLP-1 position 26 (position 20 of the chain) acylated on the epsilon-amino group with a side chain of two 8-amino-3,6-dioxaoctanoic acid (ADO) spacers, one gamma-glutamic acid spacer and 1,18-octadecanedioic acid (C18 fatty diacid); Peptide backbone produced by recombinant DNA technology in Saccharomyces cerevisiae (yeast), followed by chemical modification
Sequence (one-letter) · 31 residues
  1. H
  2. A
  3. E
  4. G
  5. T
  6. F
  7. T
  8. S
  9. D
  10. V
  11. S
  12. S
  13. Y
  14. L
  15. E
  16. G
  17. Q
  18. A
  19. A
  20. K
  21. E
  22. F
  23. I
  24. A
  25. W
  26. L
  27. V
  28. R
  29. G
  30. R
  31. G

Research overview

Semaglutide is a 31-residue acylated analogue of human glucagon-like peptide-1 (GLP-1) and an agonist at the GLP-1 receptor 1. The registered one-letter sequence is HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG, in which position 2 is recorded as substituted by 2-aminoisobutyric acid and position 20 is the lysine carrying the acyl side chain, so a plain copy of that string loses both features 2. The discovery paper reports those two substitutions together with derivatisation of the lysine at GLP-1 position 26, a GLP-1 receptor affinity of 0.38 plus or minus 0.06 nM, and a plasma half-life of 46.1 hours in mini-pigs 1. The molecular formula is C187H291N45O59 and the CAS number 910463-68-2, with PubChem returning a rounded molecular weight of 4114 for the free peptide 32. The analytical literature for this peptide is correspondingly developed. D-Ser8, D-His1 and D-Asp9 isomeric impurities have been characterised at low level by RP-UPLC with chiral derivatisation and high-resolution tandem mass spectrometry 4. UPLC-HRMS peptide mapping with Glu-C and chymotrypsin digests gave full sequence coverage at under 10 ppm mass error and localised the fatty-acid modification site, and has been applied to material of synthetic and of recombinant origin 5. A solution-state stress study tracked thirteen degradation impurities by RP-UPLC and LC-HRMS, six of which formed under every condition tested 6. This material is supplied for laboratory research only.

  1. 1.Lau J, Bloch P, Schaffer L, et al.. Discovery of the Once-Weekly Glucagon-Like Peptide-1 (GLP-1) Analogue Semaglutide. Journal of Medicinal Chemistry (2015). doi:10.1021/acs.jmedchem.5b00726
  2. 2.SEMAGLUTIDE, Global Substance Registration System record, UNII 53AXN4NNHX (API, full view). NIH NCATS / FDA Global Substance Registration System (2026). source
  3. 3.Semaglutide, PubChem CID 56843331 (PUG REST property and synonym records). National Center for Biotechnology Information (2026). source
  4. 4.Zhang B, Xu W, Yin C, Tang Y. Characterization of low-level D-amino acid isomeric impurities of Semaglutide using liquid chromatography-high resolution tandem mass spectrometry. Journal of Pharmaceutical and Biomedical Analysis (2023). doi:10.1016/j.jpba.2022.115164
  5. 5.Kim SH, Kim SS, Kim HJ, Park EJ, Na DH. Peptide mapping analysis of synthetic semaglutide and liraglutide for generic development of drugs originating from recombinant DNA technology. Journal of Pharmaceutical and Biomedical Analysis (2025). doi:10.1016/j.jpba.2025.116682
  6. 6.Malgave A, Akbar S, Joseph A, Aishwarya D, Peraman R, Malayandi R. Effect of pH, buffers, molarity, and temperature on solution state degradation of semaglutide using LC-HRMS: A preformulation protocol for peptide drug delivery. European Journal of Pharmaceutics and Biopharmaceutics (2025). doi:10.1016/j.ejpb.2025.114780

Regulatory status

Regulatory status · SemaglutideActive substance of a licensed medicine

This material is a research-grade chemical. It is not a medicinal product, has not been manufactured under GMP for medicinal use, and is not the licensed medicine whose active substance shares its name. It is supplied for laboratory research only.

The regulatory rows below describe the authorisation status of medicines containing this substance in each jurisdiction. They say nothing about this material, which is not authorised for any use in or on humans or animals.

United Kingdom
Semaglutide is a licensed medicine in Great Britain as Ozempic (injection), Rybelsus (tablets), Wegovy (injection) and Wegovy tablets, all held by Novo Nordisk Limited.Checked 2026-09-21 · electronic medicines compendium (Novo Nordisk Limited)
European Union
Semaglutide is centrally authorised in the EU under three Novo Nordisk A/S marketing authorisations: Ozempic (8 February 2018), Rybelsus (3 April 2020) and Wegovy (6 January 2022).Checked 2026-09-21 · European Medicines Agency
United States
FDA states that the semaglutide injection shortage was resolved on 21 February 2025, that the associated enforcement-discretion periods for compounders have ended, and that compounded semaglutide is not FDA-approved.Checked 2026-09-21 · US Food and Drug Administration
WADA Prohibited List
Semaglutide is not named on the 2026 Prohibited List (in force from 1 January 2026) but is on the 2026 Monitoring Program as 'Markers of Semaglutide and Tirzepatide', in and out of competition.Checked 2026-09-21 · World Anti-Doping Agency
Handling and safety

Handle as a research chemical of unknown hazard in a laboratory setting with appropriate protective equipment. Keep sealed at 2–8 °C and protected from light. Safety data sheet: available on request until the SDS is published here.

Shipping

Dispatched in insulated cold-chain packaging with a coolant, Monday to Wednesday, to laboratory and business addresses within the United Kingdom. Destination rules are on the shipping policy.

Questions

What identity data are recorded for this material?
The identity used throughout the knowledge base is CAS 910463-68-2, UNII 53AXN4NNHX and PubChem CID 56843331, with the molecular formula C187H291N45O59 [pubchem-56843331][gsrs-53axn4nnhx]. PubChem returns a rounded molecular weight of 4114 for the free peptide [pubchem-56843331]. Salt forms of semaglutide are recorded by regulators as different active ingredients and would not carry these values.
How is purity established, and against what?
Purity is reported as reversed-phase HPLC main-peak content, with identity confirmed by high-resolution mass spectrometry. Published methods for this peptide rest on the same techniques: RP-UPLC with chiral derivatisation and high-resolution tandem mass spectrometry for D-amino acid isomeric impurities [zhang-2023-jpba], and UPLC-HRMS peptide mapping giving full sequence coverage at under 10 ppm mass error [kim-2025-jpba].
What does the certificate of analysis cover?
Each lot is released against its own certificate of analysis, which records the identity and purity results, the methods used and the lot number, so that a vial can be matched to its record. No pharmacopoeial monograph for semaglutide was retrieved in the research behind this listing, so there is no official reference standard or impurity specification to compare a lot against.
What storage condition is listed for this material?
The listed storage condition is 2 to 8 °C, and the condition under which a lot was held is recorded on its certificate of analysis. No allowed source retrieved for the research dossier describes storage of the lyophilised peptide, so no literature shelf-life figure is quoted here. A solid-state study reports that the material remained amorphous under every condition tested, with a glass transition of 169 °C by modulated differential scanning calorimetry [akbar-2026-pharmres].
What does a pack contain?
A pack contains a total of 6 mg of semaglutide as lyophilised powder in sealed glass vials. Until the split of that total across vials has been confirmed for a lot, the listing states the total quantity only.